RHXF1_HUMAN Q8NHV9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NHV9
Recommended name：Rhox homeobox family member 1
EC number：
Alternative names：(Ovary-, testis- and epididymis-expressed gene protein) (Paired-like homeobox protein PEPP-1)
Cleaved into：
GeneID：158800
Gene names (primary )：RHOXF1
Gene names (synonym )：OTEX PEPP1
Gene names (ORF )：
Length：184
Mass：20542
Sequence：MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGMNRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVYIVVD
Tissue specificity：Ovary, testis and epididymis. Also detected in the prostate and the mammary gland. Expressed in many tumor cell lines derived from acute lymphocytic leukemia, prostate, endometrial adenocarcinoma, melanoma, bladder carcinoma, colon carcinoma, erythroleukemia and breast carcinoma. Not expressed in placenta. In testis, mainly expressed in germ cells, but also detected in somatic cells such as Sertoli cells, Leydig cells and peritubular cells (PubMed:28171660). {ECO:0000269|PubMed:12490318, ECO:0000269|PubMed:28171660}.
Induction：By androgen.
Developmental stage：Predominantly expressed in late stage germ cells, pachytene spermatocytes and round spermatides. {ECO:0000269|PubMed:28171660}.
Protein families：Paired-like homeobox family, PEPP subfamily