NT5C_HUMAN   Q8TCD5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TCD5

Recommended name:5'(3')-deoxyribonucleotidase, cytosolic type

EC number:EC:3.1.3.-

Alternative names:(Cytosolic 5',3'-pyrimidine nucleotidase) (Deoxy-5'-nucleotidase 1) (dNT-1)

Cleaved into:

GeneID:30833

Gene names  (primary ):NT5C

Gene names  (synonym ):DNT1 UMPH2

Gene names  (ORF ):

Length:201

Mass:23383

Sequence:MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE

Tissue specificity:Detected in skeletal muscle, heart and pancreas. {ECO:0000269|PubMed:10681516}.

Induction:

Developmental stage:

Protein families:5'(3')-deoxyribonucleotidase family


   💬 WhatsApp