NDK3_HUMAN Q13232
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13232
Recommended name：Nucleoside diphosphate kinase 3
EC number：EC:2.7.4.6
Alternative names：(NDK 3) (NDP kinase 3) (DR-nm23) (Nucleoside diphosphate kinase C) (NDPKC) (nm23-H3)
Cleaved into：
GeneID：4832
Gene names (primary )：NME3
Gene names (synonym )：
Gene names (ORF )：
Length：169
Mass：19015
Sequence：MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Tissue specificity：
Induction：
Developmental stage：Preferentially expressed at early stages of myeloid differentiation of highly purified CD34+ cells.
Protein families：NDK family